SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158314852|ref|YP_001507360.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158314852|ref|YP_001507360.1|
Domain Number 1 Region: 196-244
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000717
Family AraC type transcriptional activator 0.027
Further Details:      
 
Domain Number 2 Region: 461-508
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000121
Family AraC type transcriptional activator 0.039
Further Details:      
 
Weak hits

Sequence:  gi|158314852|ref|YP_001507360.1|
Domain Number - Region: 147-193
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0017
Family FIS-like 0.068
Further Details:      
 
Domain Number - Region: 282-338
Classification Level Classification E-value
Superfamily RmlC-like cupins 0.00609
Family TM1287-like 0.06
Further Details:      
 
Domain Number - Region: 6-47
Classification Level Classification E-value
Superfamily RmlC-like cupins 0.0835
Family Germin/Seed storage 7S protein 0.074
Further Details:      
 
Domain Number - Region: 387-463
Classification Level Classification E-value
Superfamily NTF2-like 0.0854
Family Limonene-1,2-epoxide hydrolase-like 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158314852|ref|YP_001507360.1|
Sequence length 513
Comment AraC family transcriptional regulator [Frankia sp. EAN1pec]
Sequence
MVPVERPSHMLIWVRTGRARVLLDGGTEFSLAGGEGIWMPQSYRNRTLTITEPGTVAFPY
WLDASVGAWALTKPTRFDVPDDWQDWLIQYFNLQVTPFTGHGYSPDGVADLLRGLGTRPT
SPPRGGATAPSALLAPPTMPKAAGARAVAEELIRDPALDLTVKEWATRVPSSPRTLLREF
LADTGLTFEQWRLRCRLTAAVELLAAGYDADQVAARVGFASRGGFRRAFQQQFGPTPHEF
ARELAARALAGGLTGRASAARQADKFVRLMRRDGAAAHAPDLLPAARTPLHATDSHVLSW
MYRGSGYLDIGVRRYERLRGVATWIPAGAEHITGLRQDSISLPLGNASTADLQLTEPIQV
QFPRAWDDYLMFCSISARTMLRPVDYDPARIIDLFAEQVAAQRALSVPMPTDPRGREAAT
DYLRRIGVSAGSTDFDLPAEVHRAFHEQTGMTFARWRYAARMRVARDLLVGGAKPSAVAH
RVGYAHLPTFSAAFTRFHGLSPREYQEREIGTA
Download sequence
Identical sequences A8LBT6
WP_020460603.1.9268 gi|158314852|ref|YP_001507360.1| 298653.Franean1_3042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]