SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158314875|ref|YP_001507383.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|158314875|ref|YP_001507383.1|
Domain Number - Region: 22-147
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00115
Family Tetracyclin repressor-like, N-terminal domain 0.051
Further Details:      
 
Domain Number - Region: 235-271
Classification Level Classification E-value
Superfamily Ava3019-like 0.0981
Family Ava3019-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158314875|ref|YP_001507383.1|
Sequence length 444
Comment transposase [Frankia sp. EAN1pec]
Sequence
MAIMGDVLDQLSRRFAVVLPHLDERQRRLVLATEARLLGHGGIRAVARVAGVSETTVRVG
VFELEAGGEPLPDRRVRRPGGGRKRIEDTDPAVVTALLALVEPDERGDPTSPLRWTTKSL
RHLAEQLTRQGHPVSPSTVRRLLQAAGFSLQANSKTLEGKQHPDRDAQFRYLNNQVMEHQ
KVGEPVISVDAKKKEMLGQLPNPGREWRPKGDPVQVEDHSFFTGPQGDTAIPYGVYDLTT
DAGWVNVGVDHDTSAFAVASIRRWWQARGQADYPQATRLLVTADAGGSNSYRFRAWKAEL
AALAADTGLTITVCHFPPGTSKWSRGRDRPCGRPPAQIPACGTTALGSCLRFWLRSVSPG
RDASLGLGVAIEPRSAPSVASSSGHVGCGAAAPCTSAVSPGYGRPTSCRCCRARRSRPYA
HVARSPTSVPDPGWAYAGDASAAH
Download sequence
Identical sequences A8LCY4
gi|158314875|ref|YP_001507383.1| 298653.Franean1_3065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]