SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158314987|ref|YP_001507495.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158314987|ref|YP_001507495.1|
Domain Number 1 Region: 209-444
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.2e-54
Family ABC transporter ATPase domain-like 0.00016
Further Details:      
 
Domain Number 2 Region: 120-218
Classification Level Classification E-value
Superfamily SMAD/FHA domain 4.97e-24
Family FHA domain 0.0022
Further Details:      
 
Domain Number 3 Region: 13-84
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.000000000000268
Family FHA domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158314987|ref|YP_001507495.1|
Sequence length 849
Comment FHA modulated ABC efflux pump ATPase/integral membrane protein [Frankia sp. EAN1pec]
Sequence
MDRTTLSVTSPGGQMTLMGNALCVVGRARGADIVIRDDRVSRRHLVLEPVVDGWRVRDVS
MNGLWQAGRRMRDTTTVRLAEVRFRLGAADGPEVVLAPRPVGVGASTVVGRPVAGAAVHA
RRGRHRLRPGRLGLGRSFDNDISVSDLLASRHHAELLVGAGGVEVVDLDSANGTFVNGQR
VGRAQVGQRDVIAIGHHLYQLEGDSLVEYVDSGDVAFEVQGLSVFAGAKQLMHDMTFRLP
GRSLLGVVGPSGAGKSTLLNALTGFRPANTGTVLYAGQDLYAEYDKLRWRIGYVPQADPL
HAQLTVRETLEYGAELRFPADTTAQERRARVEEVIGELGLTAHADTAVSRLSGGQKKRTS
VALELLTRPSLLFLDEPTSGLDPGNDQSVMETLKGLAKGGGAGSPDGSDRTVIVVTHSVL
FLDLCDYILVLAPGGHVAYFGPADGALRYFGKNDFREFAAVFRELERMPGAELAARFRAS
EYFVPSAVVAPIVRKPPAELPGVRQQSVSSQLATLTRRYLRIVLEDRSYLRLIITFPFLL
GVIPWVIPAPDRLKPLPDAPNPDAMKVLVVLVLCACFMGMANSVREIVKERDIYRRERTI
GLSRTAYLGSKVIVLTGVTTLQCVIFTLIGLVGRTPPEASLLGSPLVECLVAVIVAALAS
MMIGLLVSTLVDNADKTMPVLVLVTMAQLVLSGGLVSLSGRMVMEQVAWIAPARWGFAAL
ASTDDLNEVSKLGNEVLRTDPADSLWEHSAGIWVLDIALGLVLAAAALALTSVTLRHIDP
KVTRPAGPPAQTDTGGSVSSREARHRHPDRQRPDHHRPVLAYQVPVVSAADRPGRPGQRS
PRRYQPDQW
Download sequence
Identical sequences A8LEB7
WP_020460730.1.9268 298653.Franean1_3181 gi|158314987|ref|YP_001507495.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]