SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158314992|ref|YP_001507500.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158314992|ref|YP_001507500.1|
Domain Number 1 Region: 430-554
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000645
Family mu transposase, core domain 0.068
Further Details:      
 
Weak hits

Sequence:  gi|158314992|ref|YP_001507500.1|
Domain Number - Region: 290-354
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00161
Family Centromere-binding 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158314992|ref|YP_001507500.1|
Sequence length 583
Comment integrase catalytic subunit [Frankia sp. EAN1pec]
Sequence
MSPPEHDDLWPTPQADSLPSGQRPIRPDPTDHDADSAGATDRPVAGPHSHASGTPKPRRH
RRRRTIAIILLVLLALFPVFDRITVSMVEKQVVKQLETAVADTLDCNAPQPAVRRVNIAG
FPFLTQVLLGKPRDVSLSIDDLSTPGPRISSLDANAKGIKIPIYNMITGGDGKLSVDEVR
ATVKMSYTDLNAYLAGKTGHLQVKPADGGRSLNISGTVDLPLIGSQQIDGVTTFQVRDNE
IELTPSHLTLRGAINLDFLVPLGQLIPSIPIPVGELPFEVKVESVSTGLLSRVSPGRPRE
VPGRVRARILALTRTTPPPETGLSHWTSTEMARYLKRREGVSVSHTFVAQLWRENDLQPH
RHRVFKLSADPDFEAKVEDVVGLYLDPPEGAEVLSIDEKPGVQARDRTQPPRPVASGRVA
TRTHDYQRKGTTDLFAALDVGTGRVTARCFPSHTRADFLTFMDQVIAEYGGAELHVVVDN
LATHYGPDVDTWLRRHKNVTFHFTPSGGSWLNQVENWFGILTRHALQHGAFVSVQDLVNT
INNYVKNWNWDAHPFEWTATAEEIVAKVEVLHREFRKLLANNL
Download sequence
Identical sequences A8LEC2
298653.Franean1_3186 gi|158314992|ref|YP_001507500.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]