SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158315115|ref|YP_001507623.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158315115|ref|YP_001507623.1|
Domain Number 1 Region: 183-234
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000134
Family AraC type transcriptional activator 0.014
Further Details:      
 
Domain Number 2 Region: 2-50
Classification Level Classification E-value
Superfamily RmlC-like cupins 0.00000000107
Family TM1287-like 0.067
Further Details:      
 
Domain Number 3 Region: 131-180
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000188
Family AraC type transcriptional activator 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158315115|ref|YP_001507623.1|
Sequence length 236
Comment AraC family transcriptional regulator [Frankia sp. EAN1pec]
Sequence
MVTGWHSHDLHQMEYAFEGVVEVETATARYLLPPQQAVWIPAGTIHCSTWSNVKAVSVFF
DPVMGLPAGDRVRILAAAPVIREMVLYARRWPIKRTATEPMAEAFFDALAHLVVEWLDHE
TPLCLPTTPDPLVAAAMDYTNKHLTDVSLPQLCAAIGTSERSLRRAFLAATGMSWRRYLL
ESRLLKAMALLAQDSQNQTIIAIALTVGFQSVSAFTRAFGQYTGETPTAYRQRVRG
Download sequence
Identical sequences A8LFT0
gi|158315115|ref|YP_001507623.1| 298653.Franean1_3314 WP_020460858.1.9268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]