SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158315223|ref|YP_001507731.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158315223|ref|YP_001507731.1|
Domain Number 1 Region: 20-136
Classification Level Classification E-value
Superfamily Homeodomain-like 7.53e-18
Family Paired domain 0.054
Further Details:      
 
Domain Number 2 Region: 205-331
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000329
Family Retroviral integrase, catalytic domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158315223|ref|YP_001507731.1|
Sequence length 364
Comment putative transposase [Frankia sp. EAN1pec]
Sequence
MELTADQCAELNIFAKNYDTPAPVATRARIVLWQTEGRQKKEIAALAGVSRPTVDLWISR
YRKDGIDGLFDRPRGAPREQVPAMVRGRILALTRKSPPAETGLSHWSSRQMTTFIKRTTG
ASVSHFYVAKLWRDHGLKPYQQGTFKISKDPRFAEKIADIVGLYLESPGGAVVLSVDEKD
QIQALDRTQPLLPITFGAREKRTHDYVRNGTTNLFAALNVGTGEVYGECRPARDGAHFLA
FLKNAVEPHAGREVHIVLDNLGIHTTPDVRSWLTQNPHVHFHFTPIGSSWINQIETWFGI
ITRQSIRRGTFSSVQILINQIRDYIAHWNSNPEPFVWTATADEILAKVRLVQVSVKKLVG
NNSK
Download sequence
Identical sequences A8KXP1
WP_020460966.1.9268 298653.Franean1_3423 gi|158315223|ref|YP_001507731.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]