SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158315358|ref|YP_001507866.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158315358|ref|YP_001507866.1|
Domain Number 1 Region: 109-237
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.0000000000000122
Family Tetracyclin repressor-like, C-terminal domain 0.0087
Further Details:      
 
Domain Number 2 Region: 40-102
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000549
Family Tetracyclin repressor-like, N-terminal domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158315358|ref|YP_001507866.1|
Sequence length 247
Comment TetR family transcriptional regulator [Frankia sp. EAN1pec]
Sequence
MGAPGEDGDIAGSAESGAEHLARAEPPARPSAGLGRYGHRRPRRGLTRQVVVDAALRVVA
RDGLDGLTMRAVAVELNTATTSLYRHIADRDALLTAMLASVASGLPVAVPGRTPLERVAA
RLVGAHDLLADWPWVPYVLVTGQYVAAESLAFDEANLADLLAAGLDVPAAALAYRSCWHL
LVGELLDQHAAPAAAAARRLRRAAIPVVDLPALAQAGPLLTDAEGDSFAHGVALLLRAVV
AGAPSGP
Download sequence
Identical sequences A8KZ40
gi|158315358|ref|YP_001507866.1| WP_020461098.1.9268 298653.Franean1_3560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]