SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158315407|ref|YP_001507915.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158315407|ref|YP_001507915.1|
Domain Number 1 Region: 3-69
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000113
Family Tetracyclin repressor-like, N-terminal domain 0.0067
Further Details:      
 
Domain Number 2 Region: 104-184
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.0000356
Family Tetracyclin repressor-like, C-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158315407|ref|YP_001507915.1|
Sequence length 191
Comment TetR family transcriptional regulator [Frankia sp. EAN1pec]
Sequence
MASRRDDLLDAAIDLLGREGVRALTHRAVDAASGLTAGSTSNHFRTRDALFDAIVERFAA
RERANWEEVAAHLAPRTTSDLAKGLAAFARDSVGRNRTLTLSRYAILVEASRRPELRAQL
AATGARVSAWFGTWLRLVGSTDPDHHTHVVGNYLTGLVLHQLAIPGPAFDPTAHLDALLT
SLIQNQREQGQ
Download sequence
Identical sequences A8L0B4
WP_020461146.1.9268 298653.Franean1_3610 gi|158315407|ref|YP_001507915.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]