SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158315448|ref|YP_001507956.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158315448|ref|YP_001507956.1|
Domain Number 1 Region: 3-80
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000458
Family Tetracyclin repressor-like, N-terminal domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158315448|ref|YP_001507956.1|
Sequence length 188
Comment regulatory protein TetR [Frankia sp. EAN1pec]
Sequence
MGRWEPNARGRLSEAAMELYVERGFEQTTVAEIAQRAGLTARTFFRYFADKREVLFAGST
ILEEHLIAALESTPASASPMEAVAAALDAAATMLGQRREFSRRRQSVIAANAELRERELI
KMASLSGALAAGLRRRGVADSDASLAAEAGIAVFRVAFERWVGEPTDRGLTTIMRESLEQ
LKALTAAS
Download sequence
Identical sequences A8L0F5
gi|158315448|ref|YP_001507956.1| WP_020461187.1.9268 298653.Franean1_3652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]