SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158315705|ref|YP_001508213.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158315705|ref|YP_001508213.1|
Domain Number 1 Region: 14-75,110-216
Classification Level Classification E-value
Superfamily FMN-dependent nitroreductase-like 5.63e-47
Family NADH oxidase/flavin reductase 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158315705|ref|YP_001508213.1|
Sequence length 221
Comment nitroreductase [Frankia sp. EAN1pec]
Sequence
MSDLEPGSAAPAIELREAMRTARSLRRFRPDPVSDEVLARCLEAATWAPSGSNAQSWRFV
VLRSPEVRAVLGPAFREGWDWVRTIYGQADERPAPDDDSREARLTRTMLHLVDNFESVPA
YVLFCYRLTGFVPEFIEGGSIYPAMQNFLLAARAEGLGTVPSTWFTFAEEKLRAVVGIPD
EWRIASLVSVGWPVGKHGPVRRRPLHKVAALDTWDNPLLNG
Download sequence
Identical sequences A8L4D9
WP_020461442.1.9268 gi|158315705|ref|YP_001508213.1| 298653.Franean1_3917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]