SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158315846|ref|YP_001508354.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158315846|ref|YP_001508354.1|
Domain Number 1 Region: 8-69,268-366
Classification Level Classification E-value
Superfamily FMN-dependent nitroreductase-like 9.29e-17
Family NADH oxidase/flavin reductase 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158315846|ref|YP_001508354.1|
Sequence length 367
Comment hypothetical protein Franean1_4061 [Frankia sp. EAN1pec]
Sequence
MESVTAGVGREVAVEVVTTASLAPSIHNTQPWRWRLADGRLTLRPDVERRLAVLDPDGRQ
LLVSCGAALLHARLAFRVLGFEPVVELLPEATGSGGLEPVLSGGLVLASMGIGGRAAPTD
SDRLLFSAAGARHTDRRPFEARPLAGDLVDRMRRAAESEGAWLMPLSHSDQRLDAAVVAA
RADWAEQADPAYRAELASWRRGQGPTADGVPTGVASTHHPERASDFPLRDFDTRGAPGIA
APRSEEADGGADADAGLAPTVEQRPEELPSVERPAVVVVGTDADQAEDRLRAGQALARVL
LTVTAAGAAASPMGQPIDSDGYRSVIERMLSIAGHVQMILRVGYPRRDAVASALTPRRPI
GEILTFG
Download sequence
Identical sequences A8L5T8
gi|158315846|ref|YP_001508354.1| WP_020461583.1.9268 298653.Franean1_4061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]