SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158315959|ref|YP_001508467.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158315959|ref|YP_001508467.1|
Domain Number 1 Region: 67-116
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000112
Family AraC type transcriptional activator 0.049
Further Details:      
 
Domain Number 2 Region: 15-65
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000179
Family AraC type transcriptional activator 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158315959|ref|YP_001508467.1|
Sequence length 147
Comment AraC family transcriptional regulator [Frankia sp. EAN1pec]
Sequence
MSSSPAATQRLRDLARLRRVRDRIDREYAQPLDVEALARGAHMSAGHLSREFRLAYGESP
YAYLMTRRIERAMALLRRGDLTVTEVCFAVGCSSLGTFSSRFTELVGMPPSAYRHHAAAA
TAGMPSCIAKQITRPVRNREARSPSRT
Download sequence
Identical sequences A0A1S1Q2H5 A8L887
298653.Franean1_4177 WP_020461695.1.13248 WP_020461695.1.9268 gi|158315959|ref|YP_001508467.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]