SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158316032|ref|YP_001508540.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158316032|ref|YP_001508540.1|
Domain Number 1 Region: 75-285
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 0.000000000034
Family Nitrous oxide reductase, N-terminal domain 0.039
Further Details:      
 
Weak hits

Sequence:  gi|158316032|ref|YP_001508540.1|
Domain Number - Region: 601-623
Classification Level Classification E-value
Superfamily SH3-domain 0.00442
Family SH3-domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158316032|ref|YP_001508540.1|
Sequence length 634
Comment hypothetical protein Franean1_4250 [Frankia sp. EAN1pec]
Sequence
MYSGSAWLVSTRKGEIVRVNGLAGRVDAAPVGITRPGDAVQVVQTDDLVLVAANAYLSSI
DPRLLAPTRGASLQSAGARILATGKRAYVLDPASETVYRLDPRTLRPAGPMVALPGRAGD
TALQEGGERLWVALPDLGALTLVENDVAGMPVPAGAPGPHLVFARVAGQTWVLNGNDGTA
GQLRADGATSRRIQLGADYEGTALLPAAGDSPLLVFALPGSRRLAVLEPGREQPRIESIP
VAVGPLGAPLVADGLVYVPDEGSGRLAVYDLARHEFKSPISVTATAATDLELFRAGGMVW
ANAMSTPDAVAVYDGVVHRIVKYGEPAAPPIAPSPTRTPAATAPPNPNPNPKTPASAIPT
RSVPGTPSAGPAAGGAGPSSATPPARATSPARGGDAGPSGEDGADDAATGPPERVPDLTG
DDSTDSARRPGENGGIPITRRNGPYTHQTAFGRVVVEAGNGYVDVSWELPAGEGGPTDLA
WMAGARGGGGAGNGGPLPPGSTSTRFNVTYTGDTPTLTFSSAANTFSFDIRAWELCDFCN
YGHPTYTVPLRDAPHGTPIGTALPPVPDGQMGNQVELHCVAESTVEYADPVYPGRVGTFA
WYKITYQGATGYVPTNYISIPDTGMEPRYAVRPC
Download sequence
Identical sequences A8L8G0
gi|158316032|ref|YP_001508540.1| 298653.Franean1_4250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]