SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158316133|ref|YP_001508641.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158316133|ref|YP_001508641.1|
Domain Number 1 Region: 741-843,888-934
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.05e-27
Family Glutathione peroxidase-like 0.007
Further Details:      
 
Domain Number 2 Region: 596-713
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.57e-24
Family cAMP-binding domain 0.0014
Further Details:      
 
Domain Number 3 Region: 462-580
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000000000000119
Family cAMP-binding domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158316133|ref|YP_001508641.1|
Sequence length 948
Comment cyclic nucleotide-binding protein [Frankia sp. EAN1pec]
Sequence
MTVSTQPQQRQAAPAPAATETATVTVWDRLADAANPARYRPKRQDGLIWRELRSARGEEY
VIVQNPDAATYRKITMAEFYLFELMDGSRSVQDLVVAYMMKYHRFALPLVLRLVRNLKVG
QMLTDPPRFVFGPLGEQLRRRPVSSFATGFAKSFVRREFPLHGLDGLVGRAYDRGVWVLF
TRPAKIVMFAVAMLGVPLLAWSLSSSASGLADQSLVVTVPTMYGCLLVVAVLHELAHAFA
AKSYGRVVRRGGLSIFYGSPGMFVDTQDMWMEPRGPRMVSAWAGPFSGFVLAGLSGIVLV
ATPDAPWAAVVAIFGTAALAVNLAQLTPLIQLDGYYMLMDWLELPNLRARALGFIRGELP
GKVRRRERFDRTERVLTIFGLAAAAYTGYVLVLAAGFAWVRAKTMVSDAVAVPSLGRVLA
ATVVLLLTLPLLYVLGQRLWRGGSSLVVASRRLRRLAAERRYRERVAVLANVPPVAELGK
AYVQWMARRTTEKVFRAGTTVVAADEVAEVFCLVLSGEAEVVESGANAGTGPGAGSALRT
LGPGDYFPPPGLPRSPLTVRALTDVHVLRLAGADFSDRLAPLLARRAENDTRADERAELE
GFALFDGLRTRDKDTLLAHLRARSCVDGEVVVAEGDPGSAFYLVRSGAVALAQTCVDGPP
RTLGAGEFFGESALLHDEPHAATATSVGETRLWELDRTTFDDVVCRYFGLSDAVRESAEA
GEATRAAEALAGTVAGRWLEIEVGDPAPGFTLDTASGPSPVSLSDYRGQVVLLWFSRGYN
CPFCREYMARLAPAVGDFERAGVQILQLAPNLVDSAREFWRGKDLPFPFLCDPEKSAYRL
CGLQDIGAGEAQRNSVRGFTRAFTTGQGRTTMHALWLDVVNPSIGERLGHHTMTAMQQGV
FLVGPDGVLRRKYVFGPLDEPPSNTELLEAAAELGSIELATTQLEAGS
Download sequence
Identical sequences A8L9N2
298653.Franean1_4351 WP_020461867.1.9268 gi|158316133|ref|YP_001508641.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]