SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158316206|ref|YP_001508714.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158316206|ref|YP_001508714.1|
Domain Number 1 Region: 9-78
Classification Level Classification E-value
Superfamily Homeodomain-like 2.21e-18
Family Tetracyclin repressor-like, N-terminal domain 0.0052
Further Details:      
 
Domain Number 2 Region: 95-178
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 4.73e-17
Family Tetracyclin repressor-like, C-terminal domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158316206|ref|YP_001508714.1|
Sequence length 197
Comment TetR family transcriptional regulator [Frankia sp. EAN1pec]
Sequence
MPPEKGALNRRGVARREQILDAAVELFARQGYRGTGLLELAERIGISHPGILHHFATKQD
LLRAVLDRRDQFANRVIRGFAGAGTFGLHNSQDAVEPEIVTRLMIVLRVENLDPEDPLHD
YFDERDRQTRGLIADEIRGGQQRGEIRSDVDPDTKAAEILALTIGLDAQWLLNPNRRTRT
ITSTRRASIATSATVHS
Download sequence
Identical sequences A8LAN3
298653.Franean1_4429 WP_020461936.1.9268 gi|158316206|ref|YP_001508714.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]