SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158316243|ref|YP_001508751.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158316243|ref|YP_001508751.1|
Domain Number 1 Region: 289-455
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.32e-22
Family Retroviral integrase, catalytic domain 0.018
Further Details:      
 
Weak hits

Sequence:  gi|158316243|ref|YP_001508751.1|
Domain Number - Region: 76-121
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0077
Family Homeodomain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158316243|ref|YP_001508751.1|
Sequence length 466
Comment integrase catalytic subunit [Frankia sp. EAN1pec]
Sequence
MGRPADWTQTVTGRAGMCSPGRPPVARWEHQQRFWAAVARGLSSEDAGVAAGVSPAVGTR
WFRNCGGMPPSDFPAPSGRYLSFAEREEIALGRARGDSIRRIARGLGRPASTVSRELRRN
AGTRGGTLVYRATLAQWHRDRRAARPKTAKLAGNERLRGYVQDRLAGPVLRGDGTVVPGP
WTAPFTGRNKPHRQDRRWASAWSPEQISRRLRVDFPDDPAMRISHEAIYQALYIERRGAL
RRELVACLRTGRALRVPRARAGRRPDGMVTPEVRIGARPVEATDRAVAGHWEGDLIIGLN
RSAIGTLVERTTRLTVLLHLPRMDGYGHEPRVKNGPALAGRGADAVRDAITRAFAELPEQ
LRRTLTWDRGKEMAGHAALTADTGLGVYFADPHSPWQRGTNENTNGLLRQYFPKGTDLSR
WTRHELATIAATLNDRPRKTLDWKTPTEAMNNQLLSLQQPGVARTG
Download sequence
Identical sequences A8LBU7
298653.Franean1_4467 WP_020461971.1.9268 gi|158316243|ref|YP_001508751.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]