SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158316259|ref|YP_001508767.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158316259|ref|YP_001508767.1|
Domain Number 1 Region: 4-223
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.91e-54
Family ABC transporter ATPase domain-like 0.00000994
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158316259|ref|YP_001508767.1|
Sequence length 241
Comment ABC transporter-like protein [Frankia sp. EAN1pec]
Sequence
MTAALEIDELTTGYFGVPVVRGISMEVRPGEVVALLGPNGAGKTSTLLAVSGLLPIMGGR
VRVDGMEVVRRRPHRMARRGLAHVPEDRGLFGELTVRENLRLGHGRTAGASERVLEYFPS
LQRRIGVRAALLSGGEQQMLAMARAVMSTPKVLLIDEMSLGLAPLVTADLAATVRRIADE
QGVAVLLVEQHVQVALRVADRGYVLSHGEMRIQGTAASLSANRALLESSYLGESQAGVHQ
S
Download sequence
Identical sequences A8LBW3
gi|158316259|ref|YP_001508767.1| WP_020461986.1.9268 298653.Franean1_4484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]