SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158316318|ref|YP_001508826.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158316318|ref|YP_001508826.1|
Domain Number 1 Region: 254-303
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000297
Family AraC type transcriptional activator 0.017
Further Details:      
 
Domain Number 2 Region: 201-252
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000598
Family Tetracyclin repressor-like, N-terminal domain 0.086
Further Details:      
 
Weak hits

Sequence:  gi|158316318|ref|YP_001508826.1|
Domain Number - Region: 20-84
Classification Level Classification E-value
Superfamily RmlC-like cupins 0.000418
Family TM1287-like 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158316318|ref|YP_001508826.1|
Sequence length 311
Comment AraC family transcriptional regulator [Frankia sp. EAN1pec]
Sequence
MDVLADVLAVSGVRGTLGARIEAGENWGWWAAASRGAAFHAVTAGTAWLASPGQSARQLM
PGDVVLLPSGTEHVLASDTDTLARTGAHAFDSWEWADSGAVRIGSGPVRTHILCAHYSHD
PAVTTQVLTLLPDLVHIRADNAGGCLDDTVRLLGRELAHPRLGTAVVLDRLVDILLIQLL
RVWLATGQARPAASWLGVLDDPVVGAAVAKLHEDPARAWTTEALAGEISVSRATLSRRFP
AVVGETPGAYLTRWRMDLAARRLRDTDDTLESIARSVGYTSVYAFNRAFTRARSQPPGRY
RVSARDSARDS
Download sequence
Identical sequences A8LC22
298653.Franean1_4545 WP_020462045.1.9268 gi|158316318|ref|YP_001508826.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]