SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158316508|ref|YP_001509016.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158316508|ref|YP_001509016.1|
Domain Number 1 Region: 4-276
Classification Level Classification E-value
Superfamily Aldolase 8.06e-62
Family HMGL-like 0.0000000323
Further Details:      
 
Domain Number 2 Region: 288-334
Classification Level Classification E-value
Superfamily post-HMGL domain-like 8.24e-17
Family DmpG/LeuA communication domain-like 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158316508|ref|YP_001509016.1|
Sequence length 336
Comment 4-hydroxy-2-ketovalerate aldolase [Frankia sp. EAN1pec]
Sequence
MSGPNIYLQDVTLRDGMHAIRHRVDPERVGAIVAALDKAGVRAIEVTHGDGLAGSSLTYG
PGSHTNWEWIEAAVTNASQATITTLLLPGVGTIAELRRAHAMGVGSVRVATHCTEADVAA
QHIAAARELGMDVSGFLMMSHMAEPAELAAQAKLMESYGAHCVYVTDSGGRLTTDRVRER
VRAYRDVLRPDTQIGIHAHENLSLSVANSFAAVEEGAYRVDASLAGQGAGAGNCPIEPFV
AVALLLGWDLDCDLLALEDAAEDLVRPLQDRPVRVDRETLTLGFAGVYSSFLRHAEIAAE
TYGVDARSILIEAGRRKLVGGQEDMLVDIALAIQPK
Download sequence
Identical sequences A8LEP8
298653.Franean1_4743 WP_020462232.1.9268 gi|158316508|ref|YP_001509016.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]