SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158316530|ref|YP_001509038.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158316530|ref|YP_001509038.1|
Domain Number 1 Region: 253-303
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000502
Family AraC type transcriptional activator 0.0077
Further Details:      
 
Domain Number 2 Region: 200-250
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000489
Family Tetracyclin repressor-like, N-terminal domain 0.062
Further Details:      
 
Weak hits

Sequence:  gi|158316530|ref|YP_001509038.1|
Domain Number - Region: 32-115
Classification Level Classification E-value
Superfamily RmlC-like cupins 0.000163
Family TM1287-like 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158316530|ref|YP_001509038.1|
Sequence length 312
Comment AraC family transcriptional regulator [Frankia sp. EAN1pec]
Sequence
MDLLSDLLSAMRTGQPYAGKTRCRAPWGVLFPAGDAAACHVVLQGSCWLIPQHGAPLALG
VGDVVFTPHGDAHAIVDQPGSPTIDYHPKRGDESTIREMTIPGSGATTEMLCASYSFDQA
RPHPLLHGLPQVVHLPARVGHHSDLRAAVDLLGNELRQPRAGTEAIVPALIDMLLLYVLR
AWLEEQSGHALTGWVMALNDPAISTALHHIHRHPGRPWSVEDLAREAGLSRAAFAKRFAS
TVGQPPLAYLTWWRMTTAARLLRESKAPLSAVAERCGYRSEFAFAKAFKREFGAAPGRYR
RQGQPGQDLSEK
Download sequence
Identical sequences A8LES0
gi|158316530|ref|YP_001509038.1| 298653.Franean1_4765 WP_020462254.1.9268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]