SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158316552|ref|YP_001509060.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158316552|ref|YP_001509060.1|
Domain Number 1 Region: 83-346
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.28e-62
Family Protein kinases, catalytic subunit 0.0000295
Further Details:      
 
Weak hits

Sequence:  gi|158316552|ref|YP_001509060.1|
Domain Number - Region: 576-636
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0294
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0099
Further Details:      
 
Domain Number - Region: 508-570
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0327
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158316552|ref|YP_001509060.1|
Sequence length 723
Comment PASTA sensor-containing serine/threonine protein kinase [Frankia sp. EAN1pec]
Sequence
MISPADGQAESDEAGDIHGTEDIQETDGSGDSRGTGAPAVGSPGPAASDHAHAEAASPDE
RPAANRSELTRPMVALSAEEPTRIGDYQLLGLLGRGGMGSVYLGRSPAGRQVAVKVVRSD
LAADPEFLRLFHREAQLARRVARFCTAEVLDVGADAGRPFLVTEYVDGPTLWDAVNSGGP
FGAAQLERIAIAVATALTAIHGAGMVHRDLKPSNVMLSGAGPLVIDFGIAHALDGTTQLS
RTSTGTPAFMAPEQARGEGVGPAADVFAWGGVVVFAATGRPPFGTGRPEVLLYRVVHERP
DLSDIPRPLRAVVAAAMRSEAAARPSAQELYNLLLTAATQASPVVVSPLPAVSTDETDVA
SETGTEIDADTTTVGASDSGTDLPAAAPERSIEVDDATQADETASMAPSDFVAPGVGGPG
LSDGSAGVPGPEPSGLGVTPAVPTRRRVRAWRPLNTSGGSLADGSRREIVALGLVGVLVL
LGVLLALREAGGPGSSPRADGAQPSPMVAVPLLTGRAVADAEEALRALGLRPVRAEAVTS
DVVAAGQVVAQDPPDGRRVPAGGAVRLTLSSGSAQVEVPDVVGRTEEEAKSALTSAGFVV
TASTELSDDRLSGQVIRSVPAHPQRVARGSEVALVVSSGPATVVIPAGLEGQIYGTARQH
LKNLGLTVDGTFETSTRVPAGQVIRSRPGAGQRVAVGSTVTLTVSSGAPAPRPRPSDGQS
WSW
Download sequence
Identical sequences A8LFV1
298653.Franean1_4788 gi|158316552|ref|YP_001509060.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]