SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158316759|ref|YP_001509267.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158316759|ref|YP_001509267.1|
Domain Number 1 Region: 100-210
Classification Level Classification E-value
Superfamily SMAD/FHA domain 7.65e-31
Family FHA domain 0.0012
Further Details:      
 
Weak hits

Sequence:  gi|158316759|ref|YP_001509267.1|
Domain Number - Region: 39-69
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 0.000183
Family Ribosomal protein L40e 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158316759|ref|YP_001509267.1|
Sequence length 221
Comment FHA domain-containing protein [Frankia sp. EAN1pec]
Sequence
MSARSHRVRPLSRNIPAAVRAADRAAGLPPAGIRQEADETVFCTRCGQQNPSDALYCARC
GSPLVRPGEPVAPERPAEQTSTLNLAAALSGIEGDHVDESTERDAVAAVDALPPGSALLV
VKRGPNAGSRFLLDADLTTVGRHPESDIFLDDVTVSRRHAEFHRSPYTKGFSVRDVGSLN
GTYLNRERIDSAELTGGDEVQIGKFRLVFLTGATYGGVGVR
Download sequence
Identical sequences A8KY00
298653.Franean1_4997 gi|158316759|ref|YP_001509267.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]