SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158317001|ref|YP_001509509.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158317001|ref|YP_001509509.1|
Domain Number 1 Region: 1-198
Classification Level Classification E-value
Superfamily Phosphoglycerate mutase-like 2.83e-51
Family Cofactor-dependent phosphoglycerate mutase 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158317001|ref|YP_001509509.1|
Sequence length 249
Comment phosphoglycerate mutase [Frankia sp. EAN1pec]
Sequence
MRLLLWRHGRTSWNDAGRFQGHADPSLDLTGQRQAELVGPFIRALNPELVVSSDLRRCRE
TAARIGLPVRADARLREIDLGAWSGLTGAEAAARFPAEDAAWRRGEDVRRGGGETYEEVG
ARAGAVFDDIVAEGLPVTAGGLVVFVLHGGTARSLLGRVLGVPVQNWWVFGPLGNCRWSM
LRREPGGFRLVEHNTGPLATVAAAPDKVVSVGPGSTASHPPAEAILPTQEAPTASDTEPV
HSQTQPTSG
Download sequence
Identical sequences A8L0S0
WP_020462715.1.9268 298653.Franean1_5245 gi|158317001|ref|YP_001509509.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]