SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158317016|ref|YP_001509524.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158317016|ref|YP_001509524.1|
Domain Number 1 Region: 1-100
Classification Level Classification E-value
Superfamily L21p-like 1.96e-31
Family Ribosomal protein L21p 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158317016|ref|YP_001509524.1|
Sequence length 105
Comment 50S ribosomal protein L21 [Frankia sp. EAN1pec]
Sequence
MYAVVASGGKQHRVAVGDVVDVELLSGEPGAAVNLPAVLLVDGESVTHDADALASVEVTA
EVVGVVKGPKIRIHKFKNKTGYHKRQGHRQKYTRLKVTGIETGKA
Download sequence
Identical sequences A0A166RC49 A0A1S1QRB8 A8L1V8
298653.Franean1_5260 gi|158317016|ref|YP_001509524.1| WP_020462729.1.13248 WP_020462729.1.6966 WP_020462729.1.9268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]