SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158317101|ref|YP_001509609.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158317101|ref|YP_001509609.1|
Domain Number 1 Region: 1-190
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 1.94e-46
Family DJ-1/PfpI 0.0027
Further Details:      
 
Domain Number 2 Region: 210-257
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000439
Family AraC type transcriptional activator 0.021
Further Details:      
 
Domain Number 3 Region: 261-311
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000115
Family AraC type transcriptional activator 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158317101|ref|YP_001509609.1|
Sequence length 318
Comment AraC family transcriptional regulator [Frankia sp. EAN1pec]
Sequence
MHRIVVVAVPPVTTLDLSIPAAVFPAAVVHSQPAYEVVICTAEPGIVPGYTGPSVVVDRG
LDVIDSADTVIVTGTGARAHADQRVLDALQRAADDGRRIASICTGAFVLAQAGLLNGRPA
TTYWQYSQEMRRRFPAVDLRPDVLYVDDGTVLTSAGLAAGLDLCIHMIRRDHGAVVANAV
ARAAVIAPIRPGGQAQFIETPLPPENGTSLAQTRAWAAEHLAEPLTLGRLAAHAHTSTRT
LTRRFREETGLSPLQWLLHQRIDRARELLEATDLPITAVARQSGLGTPESLRLHLLRRNG
LTPRAYRDTFTRVGPTPT
Download sequence
Identical sequences A8L243
gi|158317101|ref|YP_001509609.1| 298653.Franean1_5345 WP_020462812.1.9268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]