SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158317132|ref|YP_001509640.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158317132|ref|YP_001509640.1|
Domain Number 1 Region: 263-315
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000224
Family AraC type transcriptional activator 0.017
Further Details:      
 
Domain Number 2 Region: 44-86
Classification Level Classification E-value
Superfamily RmlC-like cupins 0.00000166
Family Hypothetical protein TM1112 0.035
Further Details:      
 
Domain Number 3 Region: 210-259
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000179
Family AraC type transcriptional activator 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158317132|ref|YP_001509640.1|
Sequence length 349
Comment AraC family transcriptional regulator [Frankia sp. EAN1pec]
Sequence
MPVQVADQENDLLGELLRPIRLTGVFQSHWLLNSPWSIEGDSESDCVVLHYVIEGSCWIG
TEGARPVLLREGDLAVFPTGRSHRVSDRPDRRGVPLRTLLADRSPGTSSQLALGGEGEQT
RILCAGLYYDANTVSSLYHALPWILTLEREAVEAELLLRDIIHQLVTDRDGGPGARLITL
RIFEVFFILSLHPLLRGMMDRPEVLTALKDPAISKALLVMYTRFVEPWTIESLAREVGMS
RSAFAASFREIVGESPSSHLVLRRMRESARLLAESDIPLGAIPQKVGYKSAVGFHIAFRK
RFGITPGEYRQRFRRVTGKAPTEDGARDGTVRSTTLGREGSAPRVSTGL
Download sequence
Identical sequences A8L3A5
gi|158317132|ref|YP_001509640.1| WP_020462843.1.9268 298653.Franean1_5377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]