SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158317447|ref|YP_001509955.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158317447|ref|YP_001509955.1|
Domain Number 1 Region: 92-182
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 1.37e-22
Family Tetracyclin repressor-like, C-terminal domain 0.0026
Further Details:      
 
Domain Number 2 Region: 14-85
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000149
Family Tetracyclin repressor-like, N-terminal domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158317447|ref|YP_001509955.1|
Sequence length 206
Comment TetR family transcriptional regulator [Frankia sp. EAN1pec]
Sequence
MSVADGAVRRSRAAAGEALRREAVEAAAELLVSAGPQALTMRRVATAIGASTTVLYTVFG
GKDGVADALYREGFERLRARLEAVVAADPLVRLHELAHAYRRSALTDRSFYAVMFERAVP
GYEPGPESLEVARASLAVLVDAVRDAMAAGLLGGDDPEPVARLLHAAAHGAVSLEISGHL
EGEGALRCFRELTAAAFAASARPAAR
Download sequence
Identical sequences A8L7B4
298653.Franean1_5699 gi|158317447|ref|YP_001509955.1| WP_020463151.1.9268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]