SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158317518|ref|YP_001510026.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|158317518|ref|YP_001510026.1|
Domain Number - Region: 12-58
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0251
Family Paired domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158317518|ref|YP_001510026.1|
Sequence length 61
Comment hypothetical protein Franean1_5772 [Frankia sp. EAN1pec]
Sequence
MRRSSGSVVTWRRAQMILLSAQAMTPTKIAEVTLTSEDRVRDVIHNFNADGFDSLYPEVR
R
Download sequence
Identical sequences A8L8K4
gi|158317518|ref|YP_001510026.1| 298653.Franean1_5772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]