SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158317521|ref|YP_001510029.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158317521|ref|YP_001510029.1|
Domain Number 1 Region: 85-217
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 1.69e-27
Family Tetracyclin repressor-like, C-terminal domain 0.00075
Further Details:      
 
Weak hits

Sequence:  gi|158317521|ref|YP_001510029.1|
Domain Number - Region: 8-68
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000133
Family Tetracyclin repressor-like, N-terminal domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158317521|ref|YP_001510029.1|
Sequence length 227
Comment hypothetical protein Franean1_5775 [Frankia sp. EAN1pec]
Sequence
MEVEQIEIDQVKQAAVRRLADRRRVDLSPSALGEAAGIGLDRVTAYFAGEDELLTTLVLD
AYAGMGDGAERAGDAASAAGGSPLDRWVTISKGVRSWALDHPDEYALIWGQPVPGYHAPA
ETMVVGARTVVALLTVLRDAQRDGGLADQPPVPRLSDGMARNVAGLAAGLLQGLPDGVIA
RILVTWTQLHGMVGFEVYGHLAGVAADPGAFFEFAAREMGKYVGLTR
Download sequence
Identical sequences A8L8K7
gi|158317521|ref|YP_001510029.1| 298653.Franean1_5775 WP_020463225.1.9268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]