SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158317596|ref|YP_001510104.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|158317596|ref|YP_001510104.1|
Domain Number - Region: 47-168
Classification Level Classification E-value
Superfamily SIS domain 0.018
Family double-SIS domain 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158317596|ref|YP_001510104.1|
Sequence length 336
Comment hypothetical protein Franean1_5852 [Frankia sp. EAN1pec]
Sequence
MDLDAYVAVHRPEWIRLGQLVDRAGRPRRMSADELDELVELYQRAATHLSVIRDRSHDPN
LVDDLASLVTRGRAAVVGAPDQGWHVVGRFFAVTFPAAVYARRYWVIATTVVSLLVALAF
ALWIMNSADARANLVPPDEVADLCRSDFASYYTENPASSFASQVWTNNAWVSAQAVAFGV
LFGVPTLFVLLLNSVNLGVVGGYMGSCGEGGQFFSLILPHGMLELTVVFVAGAVGLRLGW
SIIAPGPRRRVEALAAEGRAAIGIVLGMAVVLAVSGVIEAFVTPSSLPTAIRIGIGALAW
AGFVAYVWIYGSRAVAAGERGDLDESLAADLVPVAP
Download sequence
Identical sequences A8L9R0
WP_020463298.1.9268 gi|158317596|ref|YP_001510104.1| 298653.Franean1_5852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]