SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158317601|ref|YP_001510109.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158317601|ref|YP_001510109.1|
Domain Number 1 Region: 1-58
Classification Level Classification E-value
Superfamily Trm112p-like 0.00000000000000222
Family Trm112p-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158317601|ref|YP_001510109.1|
Sequence length 66
Comment hypothetical protein Franean1_5857 [Frankia sp. EAN1pec]
Sequence
MSLDPLLLEILACPCPEHAPLRQETLDGAPVLVCESCGLAFPVRDDIPVMLLDEAKPFPA
AAGSSS
Download sequence
Identical sequences A0A1S1Q5Z3 A8L9R5
298653.Franean1_5857 gi|158317601|ref|YP_001510109.1| WP_018501528.1.13248 WP_018501528.1.66809 WP_018501528.1.9268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]