SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158317640|ref|YP_001510148.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158317640|ref|YP_001510148.1|
Domain Number 1 Region: 17-153,188-398
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 2.11e-97
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000107
Further Details:      
 
Domain Number 2 Region: 404-556
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 2.43e-29
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0000983
Further Details:      
 
Domain Number 3 Region: 154-188
Classification Level Classification E-value
Superfamily Methionyl-tRNA synthetase (MetRS), Zn-domain 0.0000000000183
Family Methionyl-tRNA synthetase (MetRS), Zn-domain 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158317640|ref|YP_001510148.1|
Sequence length 565
Comment methionyl-tRNA synthetase [Frankia sp. EAN1pec]
Sequence
MAVSTQTPDTAARHGSRPVLVAVAWPYANGAPHLGHIAGAYLPADIFARYQRMAGNRVLM
VSGSDAHGTPITVRADEEGVSPQEIVDRYHPEFLRIWSELGISFDLFTSTRTDNHSAVAQ
DVFTRLREAGYIYAKETSQFYDPDAGRFLPDRYVVGTCPHCSYQQARGDQCENCGRTLDP
ELLIDPRSKVTGAVPEMRQTTHFFLRLSSLADQLLDWLQTRQGWRRHVLNWSVQFVKDGL
HDRAITRDLDWGVPLPTDELGPGKRLYVWFEAVIGYLSASKEWAAASGDPEAWRAWWEDP
EAAAYYFVGKDNIPFHTVIWPAMLIGYGGLNLPTDVPANQYVTFGGAKASKSAGIGRGVR
EYLDLLQPDALRFALASVLPEQNDTEISDADIIRRVNDELIANWGNLVNRVLAQINKFFD
GELPETGELDGVHAALLDSVDAGLVRVGELLGKVEQRAALRAAMEISAEVNAYLYREEPW
KTVKVDRAAAARSLAVSIQAISGITTALAPFLPFSSDRVAEVLGIDLDGWERRPVPAGRR
LAWSGGLFTKLDVGALDKASLDADA
Download sequence
Identical sequences A8L9V4
WP_020463341.1.9268 298653.Franean1_5898 gi|158317640|ref|YP_001510148.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]