SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158317830|ref|YP_001510338.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158317830|ref|YP_001510338.1|
Domain Number 1 Region: 224-682
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 7.4e-85
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.0000399
Further Details:      
 
Domain Number 2 Region: 93-229
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 2.51e-29
Family Ferredoxin domains from multidomain proteins 0.00012
Further Details:      
 
Domain Number 3 Region: 17-89
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.21e-19
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.015
Further Details:      
 
Domain Number 4 Region: 706-786
Classification Level Classification E-value
Superfamily ADC-like 0.0000000249
Family Formate dehydrogenase/DMSO reductase, C-terminal domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158317830|ref|YP_001510338.1|
Sequence length 863
Comment NADH dehydrogenase subunit G [Frankia sp. EAN1pec]
Sequence
MTVAPEKPAAPAAPNHVTLTVDGLEVSVPKGTLIIRAAELLGIEIPRFCDHPLLDPVGAC
RQCIVEVEGQRKPVASCTTTVAADMVVRTQVTSPVAKKAQAGTLEFLLLNHPLDCPICDK
GGECPLQNQSMANGAATSRFKETKRAYPKPLAISSQILLDRERCVLCARCTRFSAQIAGD
PFIELFERGAAEQVAVSDGQPFSSYFSGNTVQICPVGALTSAAYRFRARPFDLVSTPTSC
EHCAAGCSLRTDHRRGKVMRRLAAEDPAVNEEWNCDKGRFAFNYARQSDRLTMPLIRDDS
TGELVEASWSEALEYAARGLAECRDRNGVGVLAGGRLTREDAYAYAKFARLALGTNDVDF
RARPHSAEEEAFLGSAVAGTGIGVTYADLEVAPAVLLVSFEPEEESPVVFLRLRKAASKH
GTAVHALAPLITRGLRKMAGTLIPVVPGGEAAALDELATGASATTEVLRAPGAVILVGSR
AAESPGALSAALRLAESTGAALAWVPRRAGERGAVSAGLLPSLLPGGRPVADVGARAEVE
SFWGTRLLGAPGRDTAGILAAAAAGRLDAVVVAGVDAEDLPDPAAALAALARVPFCVSLE
IRRSSIAEVADVVLPVAPVAEKAGTFVDWEGRLRPFQRALEGTPALPDLRVLHLLAAEMG
IDLRVPDAGAAARELSELGRAGDETGRGPAPVERVPEPVTAGPGEALLATWHLNLDDGAL
QAGEPYLAGTARPPRLLLSAATAAEIGAVEGEPVTASTSRGSVTLPLGITPMPDRVVWVP
THSPGSHVRRSLAEHAGVLVRLSAGGLLPTETAPGGEVDTFPTDETRGAALGSQLAAAQD
TAVTVAHTGLGAAGRVDTTGGRA
Download sequence
Identical sequences A8LC95
298653.Franean1_6088 WP_020463513.1.9268 gi|158317830|ref|YP_001510338.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]