SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158317964|ref|YP_001510472.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158317964|ref|YP_001510472.1|
Domain Number 1 Region: 113-222
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 2.82e-33
Family DJ-1/PfpI 0.015
Further Details:      
 
Domain Number 2 Region: 293-343
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000778
Family AraC type transcriptional activator 0.038
Further Details:      
 
Domain Number 3 Region: 246-289
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000012
Family AraC type transcriptional activator 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158317964|ref|YP_001510472.1|
Sequence length 367
Comment AraC family transcriptional regulator [Frankia sp. EAN1pec]
Sequence
MAAVGTRSCGPGLTRAVSPGPWSRPAAWDAGKSLAREHMHGLMCPRCTVVAPPTAGLPAL
AQRRVHRRRRLHGRHAGDGEHRGSRAGPSAGGRLVPLARIGRAGRTEQVGRPRSVALVAS
ALARVAAGTRVVSICTASFLLAATGLLDGRRATTHWFEAERLARMFPRVTVDPDVLFVDD
GDVLTSAGAASGIDLCLHLVRRDHGSEVANRAARRCVVPPWRDGGQAQCIERPVPPPSGT
STAGTREWMLRRLGEPTSLSELAAHARMSVRTFSRRFRDEVGLPPGQWLTGQRVERARYL
LESSDLPIDQVARHTGFATGISLRQHFRAATGVSPTAHRQTFRDRGGATLTPRSGSSSAV
LNPLDRW
Download sequence
Identical sequences A8LES6
gi|158317964|ref|YP_001510472.1| 298653.Franean1_6224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]