SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158318000|ref|YP_001510508.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158318000|ref|YP_001510508.1|
Domain Number 1 Region: 698-892
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.01e-24
Family RecA protein-like (ATPase-domain) 0.086
Further Details:      
 
Weak hits

Sequence:  gi|158318000|ref|YP_001510508.1|
Domain Number - Region: 130-207
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.0224
Family FHA domain 0.023
Further Details:      
 
Domain Number - Region: 263-375
Classification Level Classification E-value
Superfamily Bacterial luciferase-like 0.031
Family F420 dependent oxidoreductases 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158318000|ref|YP_001510508.1|
Sequence length 895
Comment cell division protein FtsK [Frankia sp. EAN1pec]
Sequence
MWITIDVAGVADTSPRAPARACLVPADSRRATRRTVLLRADGATPLGAIAAALAERAHGS
ERRPGGRGRGRSPGAVQGAREPPAAIHVDGAEVDPGLRLDASPLRDGSVLRLGAPLGAPL
GAGRNEPVGLVELRVTGGPGAGMVHRLLAGEYGLGSDPAGGVVLRGHSTPRRALSLRVDV
DGSCTITPRTGATVWIDGCRRDGPVSFPAGERGGAGPRVTLRVGGARLLLTVPDEPDALL
QPAPAGPYLEISREPRMLRAPGGSRYRLPTPPVPPRPAPPPVLATLLPAAAATGMAVLLH
AYYLLLFAALAPLSLLGSYLAARRQAAREHQRELAEYQRIRAEIDRDATAALDREAAALR
RAHPDPAATLLRALGPRRGLWERRPEDPDFLHLRVGTGDLPGGVVLDDPAAPDHRRQTRW
QLRDVPVTVPLPETGVLGVVGAGDFAKVVGSWLTAQAAVHHSPRDLAVHLVVGTASPASW
EWARWLPHCRPPDGPPGAILVGADGPGRARRVDELASMIDARLARTGGGGASQVPRDPAV
LVVVEGAASMRAALIPVLRSGPLVGVYVVCLERDPRLLPPECHTVVEQVPGGMRVRRQGA
EGVDHVCPDLVAGEPAGGGDPHPAGEPTGGPGTSAGLDAEISGPAAAAWCEQLARALAPV
RDPGPRERGPASARAETRLLELLDLDPPTARALAPRWITERAPGPVPIGVCPAGLVSLDL
SRDGPHALVAGTTGSGKSEFLQSLVASLAVRNRPDEMTFVLVDYKGGSAFGDCAHLPHTV
GLVTDLDPHLVRRALDSLGAELRRREALLADAGCKDIDDYSRAPRPSHPARQPLPRLVVV
IDEFAALVRELPEFVSGLVGLAGRGRSLGIHLVLATQRPAGVVSPEIMANTNMRS
Download sequence
Identical sequences A8LEW2
gi|158318000|ref|YP_001510508.1| 298653.Franean1_6260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]