SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158318061|ref|YP_001510569.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158318061|ref|YP_001510569.1|
Domain Number 1 Region: 4-70
Classification Level Classification E-value
Superfamily Homeodomain-like 2.15e-18
Family Alr1493-like 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158318061|ref|YP_001510569.1|
Sequence length 79
Comment hypothetical protein Franean1_6321 [Frankia sp. EAN1pec]
Sequence
MAEDLLALVVADPTVGHGQACIRGTRVPVSVVLDCLADGMSDGEITAEYPSLTVPGIRAA
AAYGARLAREDLVPLRTAP
Download sequence
Identical sequences A8LG30
WP_020463740.1.9268 gi|158318061|ref|YP_001510569.1| 2005330496 298653.Franean1_6321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]