SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158318129|ref|YP_001510637.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158318129|ref|YP_001510637.1|
Domain Number 1 Region: 23-227
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.07e-70
Family PAPS reductase-like 0.0000000737
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158318129|ref|YP_001510637.1|
Sequence length 319
Comment sulfate adenylyltransferase subunit 2 [Frankia sp. EAN1pec]
Sequence
MTPVDGTDTPVRTQKGSPGMGRLTHLQRLEAESIQIFREAVAESERPVMLYSVGKDSTVL
LHLAMKAFFPSRPPFPLLHVDTTWKFRAMYDFRDKAAAELGVDLLVYQNPECVERGINPF
DHGSATHTDMWKTEGLKQALDLYGFDLAFGGARRDEEKSRAKERVFSIRSAQHRWDPKAQ
RPELWRLYNASKAPGQSVRVFPLSNWTELDVWQYIHREKIPIVPLYYAAPRPVVERDGAL
IMVDDDRMRLEPGEVPEQRSVRFRTLGCYPLTGAVESTAGTLPEIIQEMLLTTSSERQGR
VIDHDSSGSMEKKKQEGYF
Download sequence
Identical sequences A8LG98
298653.Franean1_6393 gi|158318129|ref|YP_001510637.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]