SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158318189|ref|YP_001510697.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158318189|ref|YP_001510697.1|
Domain Number 1 Region: 11-267
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.08e-64
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 
Weak hits

Sequence:  gi|158318189|ref|YP_001510697.1|
Domain Number - Region: 405-483
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00299
Family Fibronectin type III 0.0078
Further Details:      
 
Domain Number - Region: 505-576
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00352
Family Fibronectin type III 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158318189|ref|YP_001510697.1|
Sequence length 705
Comment serine/threonine protein kinase [Frankia sp. EAN1pec]
Sequence
MAVGPDGARVVAGRYRLVARLGAGAMGTVWRAFDQVLETEAALKEIEFAGGVPDYERAER
VERALREARHAAKLRGHPHVVTILDVVLEDGLPWIVMELVPSRSLFEVVRDDGPMPVPEV
ARIGIAMIDALLAARAQGIVHRDVKPSNVLIGTDGRVVLTDFGIATGDGDPTLTVTGVLG
TPLYMAPERLNNAPATFEADMFSLGGTLYFAVEGRPPFERESFGAMLASVLLHPPTPMRL
AGPLADVLTGLLEKEPERRLPAGAARSMLDTLIINGMAAGGGSGGPSTGSVAATGTAVLG
NRGGRPVVRADGLGWQARAGDAGGQGGVGSWRVPGTLEGEPEFGSGQFRPTGPAGAVPRV
DPEAPTTLASVRPVHPGGPAAPETDGHDEAAGHGDADGAVDAGGPVSAPPPPAGVSVVEQ
DGALLITWEPSPGAETYRVIRVVPDASAGGGRRERSLASTTSTEWFDAGVPKGVQVWHEV
VAVGPSAGGGARSAPARSPARVVLPPVTALRADMTDDAVALSWRPVPGRDEVIIERTHDE
TSSMRGAMRRYRGFGGAFVDSDVQTGAVYRYRVWVAAGEESDGLRPAACAEVTARVIARP
RAVVDLEARETLGGTVLRWTTVPGSVVRVYATQAPEQAGLAGTGPFGPADREVGLGSLEG
RARLVGESRRGRLVDRDGTGTVVYTPVSIAEDRAVIGAAVTHTAP
Download sequence
Identical sequences A8LHH2
gi|158318189|ref|YP_001510697.1| 298653.Franean1_6454 WP_020463864.1.9268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]