SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158318226|ref|YP_001510734.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158318226|ref|YP_001510734.1|
Domain Number 1 Region: 458-568
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.58e-17
Family Histidine kinase 0.014
Further Details:      
 
Domain Number 2 Region: 260-329
Classification Level Classification E-value
Superfamily GAF domain-like 0.00000255
Family GAF domain 0.025
Further Details:      
 
Weak hits

Sequence:  gi|158318226|ref|YP_001510734.1|
Domain Number - Region: 41-93
Classification Level Classification E-value
Superfamily Respiratory nitrate reductase 1 gamma chain 0.00837
Family Respiratory nitrate reductase 1 gamma chain 0.027
Further Details:      
 
Domain Number - Region: 327-383
Classification Level Classification E-value
Superfamily Coiled-coil domain of nucleotide exchange factor GrpE 0.0497
Family Coiled-coil domain of nucleotide exchange factor GrpE 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158318226|ref|YP_001510734.1|
Sequence length 576
Comment integral membrane sensor signal transduction histidine kinase [Frankia sp. EAN1pec]
Sequence
MTHPRRQLLTAAALAGAAVTAACAAPRLLGAGTPPWSAPLAVDAVLLTAGVAAGWAPRAR
RRSERVLTIAADLACLAAIAAVGLAGALATLGHRPPDGGESFTGPVLIAAALAAVLAAGA
RARTAALVRHAVRGARYAPDDVLRTFGEDASRGTSLDEALAGLGDALRRSLSLQRVEIWT
GAAGRLTAAVVTPESPPATAPDAGGQDAGRPAAGGPGAAGGPGAAAGGPAEVGSTIALTA
GDLIVLARTRVAGPGWLSLWVPQLARRYLDAQVRVVPARAGGALLGMLVAQRPPEAPRFS
EAEDRMLAELGTRVGTVLHNRQLDANLRDALTDLRHANEELRGSRARLVATADAERRRIE
RDLHDGAQQQLVSLAVGLRLVRDLISDGDSDGSSSNGSSSNDGDGSVPGAPERDEDLAAA
DELLTAMAEQVTETITEVRNLAHGIYPPLLRSSGLTEALRAAGQRSTVGVTVRADDIGRY
PPDVEAAVYFCCLEALQNAAKHAPGSSVEVTLGEREGSLTFAVWDDGAGFEPESSARGHG
MTNMADRIGAIGGTLRWESSPGSGTGVIGVVPVGGG
Download sequence
Identical sequences A8LHK9
WP_020463900.1.9268 298653.Franean1_6491 gi|158318226|ref|YP_001510734.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]