SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158318236|ref|YP_001510744.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158318236|ref|YP_001510744.1|
Domain Number 1 Region: 523-827
Classification Level Classification E-value
Superfamily Aldolase 3.11e-78
Family HMGL-like 0.00000114
Further Details:      
 
Domain Number 2 Region: 83-355
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.2e-66
Family BC ATP-binding domain-like 0.00000839
Further Details:      
 
Domain Number 3 Region: 333-448
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 8.89e-40
Family BC C-terminal domain-like 0.0000957
Further Details:      
 
Domain Number 4 Region: 824-991
Classification Level Classification E-value
Superfamily post-HMGL domain-like 2.94e-37
Family Conserved carboxylase domain 0.003
Further Details:      
 
Domain Number 5 Region: 2-111
Classification Level Classification E-value
Superfamily PreATP-grasp domain 5.97e-37
Family BC N-terminal domain-like 0.0000982
Further Details:      
 
Domain Number 6 Region: 1049-1125
Classification Level Classification E-value
Superfamily Single hybrid motif 1.06e-16
Family Biotinyl/lipoyl-carrier proteins and domains 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158318236|ref|YP_001510744.1|
Sequence length 1127
Comment pyruvate carboxylase [Frankia sp. EAN1pec]
Sequence
MRKVLVANRSEIAVRVFRAAHELGLRTVAVYTPEDVSALHRTKASEAYELCEPGHPVRGY
LDIDALLRVAKQADADTLHPGYGFLSESAVLAEACAAAGVTFVGPPPAVLRLTGDKVAAR
NAAIAAGLPVLRASEPLPDGVGAQEAAAEVGFPLFVKASAGGGGRGLRRVLRPEDLAEAV
ASASREAAAAFGDGTVFLEQAVERPRHVEVQVFADGYGNVIHLFERDCSVQRRHQKVVEI
APAPALDEPIRDALCEAAVRFARHVGYVNAGTVEFLVGADGAFTFMEMNPRIQVEHTVTE
EVTGVDIVAAQLRVAAGESLIDLNLTQDAIALRGTAIQCRVTTEDPSDGFRPDTGTITFY
QSPGGPGVRLDGATYPGAEVSPYFDSLLVKLTARGSTLEKASRRARRALGEFRVRGVRTN
IEFLGRLLEDPDFLAGGVTTSFIDERPGLVNALDDGDATSRMLARLAESTVNGHARPAGV
ALTEPRTLLPPLHPTDTPAAGSRQLLTELGPAGWAADLRGRTALAVTDTTLRDAHQSLLA
TRLRSFDILAAAPALAELTPNLLSLECWGGATYDVALRFLAEDPWERLTAVRAAVPNICL
QMLLRGRNAVGYTPYPDDVVRAFVAEAAAAGLDIFRIFDALNDIEQMRPAIAAVLETNAV
AEGTLCYTGDLTDPGERIYTLDYYLRLADQLVQAGVHVLAIKDMAGLLRPAAAHALVAAL
RERFDVPVHLHTHDTAGGQLATLIAANEAGVDAVDAAAAPMSGGTSQPNLSALVAATDHT
PRATGIRLGALSAMESYWEAVRDLYSPFEAGLRAPTGAVYRHEIPGGQLTNLRQQAISLG
LGDRWAQVTECYAVANDLLGKPIKVTPTSKVVGDLALFIAGGSVDVDRLREHPEEYDLPA
SVLGYLAGELGTPPAGFAEPFRERALAGRRPEPPAATLATEDAAALAEPGAGRRAALSRL
LFPGPWKDYRKAVATYGDSSVIPTEAFLFGLVPGRPASVMLEPGVEIIVTLETVGEPDSG
GMRTLYLRVNGQPRPVRVRDNSIKATATAARRADPSDPTHVGAGLPGIVTFAVAAGDEIE
KGQKLAVVEAMKMEAAVTSPAAGKIAELVRSSGESVEVGDLLLILRP
Download sequence
Identical sequences A8LHL9
WP_020463910.1.9268 gi|158318236|ref|YP_001510744.1| 298653.Franean1_6501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]