SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158318238|ref|YP_001510746.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158318238|ref|YP_001510746.1|
Domain Number 1 Region: 210-375
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 0.00000000000681
Family TatD Mg-dependent DNase-like 0.042
Further Details:      
 
Weak hits

Sequence:  gi|158318238|ref|YP_001510746.1|
Domain Number - Region: 159-225
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.000522
Family Interferon regulatory factor 3 (IRF3), transactivation domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158318238|ref|YP_001510746.1|
Sequence length 407
Comment amidohydrolase 2 [Frankia sp. EAN1pec]
Sequence
MESLSLVDHHCHGLLLRDLDRPDFERMLTEADEPGPAGTTLFDSHIGFAVRRWCAPVLDL
PRHAAPDVYLARRRELGVEEVNRRFLRAAGIGAFCVDAGYLPEPLTSATELATAGGGTGH
DILRLERLAEALAVDILTGQLGVTHFADTVRERVTGASPTTVGLKSVAAYRVGLDLPATR
PTDREVAAAVRDWLGLIRRGVPIRLADPVLHAFLIWTGVDAGLPVQIHVGYGDAELDLHR
CNPLLLTGLLRALAPTGVPVMLLHCYPYHREAGYLAQVFPTVHLDVGLAVHNVGRRAPAL
LAEALELAPFSRFLFSTDAFGLAELYLLGARLFRQALSTVLGDGIADGDWTDDDARRVAE
LIGAGNARRIYRLSEPGRETTAVTSSRSSGRSSGPRVTAPAPATLED
Download sequence
Identical sequences A8LHM1
298653.Franean1_6503 gi|158318238|ref|YP_001510746.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]