SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158318299|ref|YP_001510807.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158318299|ref|YP_001510807.1|
Domain Number 1 Region: 32-219
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.8e-48
Family Extended AAA-ATPase domain 0.00000673
Further Details:      
 
Domain Number 2 Region: 251-362
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 6.97e-18
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158318299|ref|YP_001510807.1|
Sequence length 855
Comment DNA polymerase III subunits gamma and tau [Frankia sp. EAN1pec]
Sequence
MSTALYNRYRPATFAQVVGQEHVTEALGHALRSGRLHHAYLFSGPRGCGKTSSARILAAS
LNCEKGPTPEPCGVCDQCVSIRTGSSMDVTEIDAASHGLVDDARDLRERAFFAPASARFK
VFVVDEAHMVTAAAFNALLKVVEEPPSYLKFVFATTEPDKVIATIRSRTHHYAFRLVPPG
VLRKHLESICAQEGVVVEPSVLPLVVRAGAGSVRDSLSVLDQLLAGAGDGGLSYERAVAL
LGMTDGILLDETVDALAERDGAALFTVVDSVVSSGHDPRRFATDLLDRLRDLIVVAAVPD
AVERGLLEAFSTDQVDRMRAQAGRIGPVELSRTADVLHAGLVEMRGTASPRLLLELILAR
ALLPGAAGDPAALAVRLERLERRAVVGGGAGAGTTPTGGAEVGGATHADARFGGARPADG
GPGFGGAADSAHGQAAAHAPAPAAHTQTARPASPARPAMPAAAAPGGGGLDAAALNARWD
EVLALAVQRSRRTHAILKDYASVAEVRGDEVVLAFSAPAMAKMFGQGNNVEILATLLAEK
FGGTWRVTIGGGPGSSGGRPQAPRGGPGNGRPDNGNGGGPGGYSGPGGPGGPGGPGGGQR
GPTEQAGGGRPAEAVAPQRPNGYGGPAGQASPGGPSSPGAVDPSGGHPGGYSDAHGGPAV
PVNAGAPGGWSAAGAGASRGSGAPGATLPAPSGVSAAPASMAHAGSSGPAAQDGLPRPPA
GLHSATATASLGNASVSGAAAGSGVGSTAVAVPRLGTAEAGLAAARAAVSARTGLNGSTR
TPTGPGGGPRAAGAARPGGASVAAASMSATDTAPDEVSLDDEDAPTQLGGARGGEDAAVA
LLRTSLGATVIEQSG
Download sequence
Identical sequences A8KYB1
gi|158318299|ref|YP_001510807.1| 298653.Franean1_6564 WP_020463973.1.9268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]