SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158318395|ref|YP_001510903.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158318395|ref|YP_001510903.1|
Domain Number 1 Region: 42-157
Classification Level Classification E-value
Superfamily DsrEFH-like 0.000000000000013
Family DsrEF-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158318395|ref|YP_001510903.1|
Sequence length 169
Comment hypothetical protein Franean1_6660 [Frankia sp. EAN1pec]
Sequence
MELTELELQSLTEVPHPSLPPGSNLYGSTKLFPDYQAEDGESYLTLVHGIAHESSVSFVA
ILQATRALRKGFESVIYFYGPGAMNCMATRGFPHTGDSAFAGEHNINTQIETFIKEGGKV
YVCRFGLSLHGLREEDLIEGVIPAHPLDIQDCVIHYTRKGAIVNSTYML
Download sequence
Identical sequences A8KZL7
298653.Franean1_6660 gi|158318395|ref|YP_001510903.1| WP_020464067.1.9268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]