SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158318447|ref|YP_001510955.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158318447|ref|YP_001510955.1|
Domain Number 1 Region: 239-290
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000152
Family AraC type transcriptional activator 0.026
Further Details:      
 
Weak hits

Sequence:  gi|158318447|ref|YP_001510955.1|
Domain Number - Region: 183-238
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0185
Family Tetracyclin repressor-like, N-terminal domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158318447|ref|YP_001510955.1|
Sequence length 298
Comment AraC family transcriptional regulator [Frankia sp. EAN1pec]
Sequence
MPTTMASDHADCFRGRIDVSGLSGTTVVALTFSPLSGRRSPALIRHHDPEDYYLFMVHGS
PIRLEQSGNVTCLTAGDMALFDTSHPLAADFLDHGRQKRVTLMRLPRASLPLPGGTTDCL
LGNTLLTRTPTGALLGQFLSGFRENAAACGSAELHRLGRIGFDLAVTFLASHIDAQHTLP
VETREHVLRARIDAFIEHNLGDRGLRPATIAAHHHISVRTLHQLFQGQPETVSAMIRRRR
LERCKVDLLNPQLRHHTIGDISARWGFRHPADFSRAFRAAYGAPPRDLRHPESHGPCT
Download sequence
Identical sequences A8L0T7
gi|158318447|ref|YP_001510955.1| 298653.Franean1_6715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]