SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158318515|ref|YP_001511023.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158318515|ref|YP_001511023.1|
Domain Number 1 Region: 200-283
Classification Level Classification E-value
Superfamily PKD domain 0.0000327
Family PKD domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158318515|ref|YP_001511023.1|
Sequence length 608
Comment hypothetical protein Franean1_6783 [Frankia sp. EAN1pec]
Sequence
MGARLTRILASAGLAVLAAIGVLTVGSGVAARAASPGWLWIPKVDSCVATSNGSAGSSIT
LSWKGRTNCPTGDLFNFSATLHQLGAPDVLLYAVQSEASTATFKLPALVDEIHYNIEVWG
ISYRYWDDGSGQYYQLAGGYAGLFYPDPDGDGCAYSPAVANPTNCQGPTPSPSPTRSPSP
TPSPTPPTSPSPTPKPTPTAPAVSAGADRTVAGQRSVTLAGKVSGASATAWTQLAGPGQV
TFSAGSANAVATFSTLGTYALRLTAVSPTGLSAHDDVTIRIVDHYRVELKSWIPQSSTAD
PFVLAPVSFPNPYIPLMGQPLRSCFAAVSSGSPNGSVRVVSSEFAGDGHRVYGVTGPAND
TGRASDVRIITTAELDWDGKALTGLSAKLGVGTTTRTFTIVGDTGKRATCRLVGHADPSV
NPGAKISSPATLTIGVKGSDPLTPTSAAPMLQAVKDICQSALPGPASLKAICAVPTSWTS
TIPITPSLDGAITATPTSTGLRVTYTTDRFPSYGIAVRRNSETSATAVITDASCMPGTGY
DGAATVLAGLQTVIGDKATGTLNLPYTSSVCRQLPAAVTAPIAASLRVGINTLTEPVLIL
AASRVPQS
Download sequence
Identical sequences A8L105
298653.Franean1_6783 gi|158318515|ref|YP_001511023.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]