SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158318698|ref|YP_001511206.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158318698|ref|YP_001511206.1|
Domain Number 1 Region: 2-64
Classification Level Classification E-value
Superfamily Homeodomain-like 1.03e-16
Family Tetracyclin repressor-like, N-terminal domain 0.0046
Further Details:      
 
Domain Number 2 Region: 124-223
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.00000169
Family Tetracyclin repressor-like, C-terminal domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158318698|ref|YP_001511206.1|
Sequence length 229
Comment TetR family transcriptional regulator [Frankia sp. EAN1pec]
Sequence
MNTTRRRDAARSRQALLAAAADLFAERGYAGTAIRSVGDRAGVDPALIARYFGGKEGLYQ
AVLAADPLIEQSAPSADGPPAAPHAPVPAASGDDGAGDDGAAAGTVAGPPDEPAASPLAT
VHGMVDRAFDKWTSTGVSAAAQNVFRREVDDAARQATRERLDTVLEPLRGAADSPDPQLA
AELAVAVLFGVGVARDAGTLTRLSAVSVDELRAPLTAALVAALGITDCQ
Download sequence
Identical sequences A8L3P0
WP_020464366.1.9268 298653.Franean1_6966 gi|158318698|ref|YP_001511206.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]