SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158318734|ref|YP_001511242.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|158318734|ref|YP_001511242.1|
Domain Number - Region: 333-391,426-461
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 0.0445
Family Nitrous oxide reductase, N-terminal domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158318734|ref|YP_001511242.1|
Sequence length 552
Comment hypothetical protein Franean1_7005 [Frankia sp. EAN1pec]
Sequence
MSHALHHALEPSAEYNVDLTVTAGRWPDGLAGNIFVIGPSQPTAVDFMFAGPGLLTHVDL
ETRHWRTKRVVTPDLALLGGLSRALPPAELAGLTVGGRPSLTNVSPHFFGDRLLLTGLSQ
RPVEFDPATLEFKTFLGGVSEYPEVVAHPLFPGVRTAAHPVEDLDDGCMWWCNTNLRPRG
SSTSDMEGPMWVVRWDGHGDVETWHVPGAHLTQGVHEMTVTQDYVIFTEIGFQPEPGTVA
GRGRTKPHLPFTDIYLVGKRDLTVARRGRSVPVAHARVPRESFHHFADYRQDGDDVTMYL
AHSNGWDLNYVLTDADSVWGTGSGLAKGLHGFVSAPVDASPVGRYVIDGRTGEVRDSHVF
LDPERHWATLLYGRDMRRPGLERGRYLWQSYWGCDTEMLATRIVEMYRDHPYRVVPVDQL
PSREIPSSLVCIDLETMTEQSAWSFPAGTTSESPVFVPDPAGGPGWAVIFVHYSDRTELQ
VFDALALGAGPVAVATAEGLKLSVQFHSAYLPSIRLRDTGYERSFAADLGDGWRDFSPSA
RGVISKVLERYG
Download sequence
Identical sequences A8L4T7
298653.Franean1_7005 gi|158318734|ref|YP_001511242.1| WP_020464402.1.9268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]