SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158318809|ref|YP_001511317.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|158318809|ref|YP_001511317.1|
Domain Number - Region: 179-235
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 0.00959
Family Sigma4 domain 0.02
Further Details:      
 
Domain Number - Region: 4-100
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0116
Family Homeodomain 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158318809|ref|YP_001511317.1|
Sequence length 334
Comment hypothetical protein Franean1_7081 [Frankia sp. EAN1pec]
Sequence
MKSARERMDVISAYREVGSYRGAAAMCGTTPKTVRRIIERHENGGGRPVRGRRARNYDSV
AELVAGRVKATSGRISAKRLLPVARAAGYDGSPRNFRRLVAEARADWRVGHHRGRRPAVW
APGEALAIDWGVLGGLHVVLRGAGLVTGPVRPVRRGRAGGHDVRVAGYRLLCEEVRISCT
YGMLLCLSWPVRAAYLLGDVLGAPDTAGAAICEITPAAFRQRVSRARRTIRQVIDNRCGL
VNPANPCRCGRQIEGGLAAGILDRDNLTFARHPRELAATPAVGWLEPAAAQLDLAVAIGE
LYRADRFAAPGDMWAQVQQACPDLLAAPNGAAGG
Download sequence
Identical sequences A8L512
298653.Franean1_7081 gi|158318809|ref|YP_001511317.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]