SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158318820|ref|YP_001511328.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158318820|ref|YP_001511328.1|
Domain Number 1 Region: 30-137
Classification Level Classification E-value
Superfamily Homeodomain-like 1.61e-17
Family Paired domain 0.093
Further Details:      
 
Domain Number 2 Region: 202-341
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000169
Family Retroviral integrase, catalytic domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158318820|ref|YP_001511328.1|
Sequence length 362
Comment putative transposase [Frankia sp. EAN1pec]
Sequence
MPGPSAEPIELSAAERAVLEGWARRRKTAQALALRSRIVLACADGGTNSGVAAGMGITRG
TVAKWRNRFTVDRLEGLSDEERPGAPRKVTDAQVEAVIARTLEEKPPNGDTHWSSRSMAR
ASGLSQSTVSRMWRAFGLKPHLVETWKLSTDPLFVDKVRDVVGVYLDPPEKAIVLCVDEK
SQVQALDRTAPVLPMMPGTPERMTHDYVRHGTTSLFAALDPTSGSVIAQTYRRHRHQEFL
RFLKLIDGSVPKGYDLHLVLDNYATHKTPAVKNWLLRHPRFHLHFTPTSASWMNLVERWF
AELTNRKLRRSTHRSVVELEADIRKWINAWNKDPKPFVWAKTADEILETLAAYCQRISDS
AH
Download sequence
Identical sequences A8L523
WP_020460528.1.9268 gi|158314775|ref|YP_001507283.1| gi|158318820|ref|YP_001511328.1| 298653.Franean1_2957 298653.Franean1_7094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]