SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158318823|ref|YP_001511331.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158318823|ref|YP_001511331.1|
Domain Number 1 Region: 4-87
Classification Level Classification E-value
Superfamily Homeodomain-like 2.41e-17
Family Tetracyclin repressor-like, N-terminal domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158318823|ref|YP_001511331.1|
Sequence length 206
Comment TetR family transcriptional regulator [Frankia sp. EAN1pec]
Sequence
MTTPRRVGAETSKTRAALLDSAERLMLSEGYAAVTYRGVASRAGVTSGLVQYYFPTLDDL
FLALVRRRTDQTLGVLVEALRTDHPLRALWEFSNNWTAGALITELTALANHRKKIRTEIA
AVGEKVRELTLEALSRSSNDYTVPLGRVPAEVLVFLVTSSPRMVIMEQSVGMSTSHAETI
DFVERYLDKVEPRTARESAASRESDT
Download sequence
Identical sequences A8L526
WP_020464489.1.9268 298653.Franean1_7097 gi|158318823|ref|YP_001511331.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]